Amyloid β-Protein (1-40)

CompanySerial Number：HD130002

ProductName：Amyloid β-Protein (1-40)

Synonym：

CASNo.：[131438-79-4] net

Sequence(three-letter)：H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHTrifluoroacetate salt

Sequence(one-letter)： DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHTrifluoroacetatesalt

ConstitutionalFormula：

MolecularFormula： C194H295N53O58S

MolecularWeight：4330.09

References： B.A.Yankneret al., Science, 250, 279 (1990)

M.A.Kowalska and K.Badellino, Biochem. Biophys. Res. Commun., 205, 1829 (1994)

A.Klegeris et al., Biochem. Biophys. Res. Commun., 199, 984 (1994)

M.Pitschke et al., Nat. Med., 4, 832 (1998)

G.Bitan et al., Proc. Natl. Acad. Sci. USA, 100, 330 (2003)

D.M.Walsh and D.J.Selkoe, J. Neurochem., 101, 1172 (2007)

A.Jan et al., Nat. Protoc., 5, 1186 (2010)

Illustration：Amyloidβ-protein (1-40) showed both neurotrophic and neurotoxic effects in dependenceon the neuronal age and the concentration of the β-protein. Aβ 1-40 has beenused as well as Aβ 1-42 to detect amyloid β-protein multimers in thecerebrospinal fluid of Alzheimer's disease patients. H-2972, the inverted Aβ1-40 sequence, can be used as inactive control in experiments employing H-1194.For detailed descriptions of the preparation of wild-type and mutant Aβ 1-40monomers and protofibrils please see the paper of Jan, Hartley, and Lashuel.

ConditionOf Storage: -20± 5 °C