| Catalog Number: 10129 |
| Product Name: Rab3A Protein Q81L mutant |
| Synonyms: Member RAS oncogene family |
| Source: Human, recombinant full length, His6-tag |
| Expression Host: E. coli |
| Molecular Weight: 25 kDa |
| Purity: >95% by SDS-PAGE |
| Introduction: The Rab3 small G protein family consists of four members, Rab3A, -3B, -3C, and -3D. Rab3A is found specifically in brain and regulates a late step in synaptic vesicle fusion. Rab3A -mediated synaptic transmission is involved in circadian period and sleep homeostasis. |
| Amino Acid Sequence (1-220, Q81L) |
MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRN
DKRIKLQIWDTAGLERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVG
NKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQ
GPQLSDQQVPPHQDCAC |
Properties
|
| Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form): White or clear |
| Concentration:1 mg/mL |
| Storage: -80°C |
Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab3A Q81L was determined by SDS-PAGE and Coomassie Brilliant Blue Staining. |
 |
References:
1. Geppert, M. et al., Nature 387: 810-814, 1997.
2. Giovedi, S. et al., J. Biol. Chem. 279: 43769-43779, 2004.
3. Huang, Y.-Y. et al., Proc. Nat. Acad. Sci. 102: 9365-9370, 2005.
4. Kapfhamer, D. et al., Nature Genet. 32: 290-295, 2002.
5. Rousseau-Merck, M. F. et al., Genomics 5: 694-698, 1989.
6. Rousseau-Merck, M. F. et al., Cytogenet. Cell Genet. 51: 1070-only, 1989.
7. Sullivan, M. et al., Cell. Signal. 11: 735-742, 1999.
8. Trask, B. et al., Genomics 15: 133-145, 1993.
9. Zahraoui, A. et al., J. Biol. Chem. 264: 12394-12401, 1989. |
|
