| Catalog Number: 10167 |
| Product Name: Rab7 Protein |
| Synonyms: Member RAS oncogene family, Rab7a, MGC102153 |
| Source: Human, recombinant full length, His6-tag |
| Expression Host: E. coli |
| Molecular Weight: 23 kDa |
| Purity: >95% by SDS-PAGE |
| Introduction: Members of the Rab family of Ras-related GTP-binding proteins are important regulators of vesicular transport and are located in specific intracellular compartments. Rab7 has been localized to late endosomes and shown to be important in the late endocytic pathway. In addition, it has been shown to have a fundamental role in the cellular vacuolation induced by the cytotoxin VacA of Helicobacter pylori. |
| Amino Acid Sequence (1-207) |
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQIWDTAGQ
ERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPFVVLGNKIDLENRQV
ATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEVELYNEFPEPIKLDKNDRAKASAESCSC |
Properties
|
| Physical Appearance (form): Dissolved in 20mM Tris-HCl, pH8.0, 150mM NaCl. |
| Physical Appearance (form): White or clear |
| Concentration: 1 mg/mL |
| Storage: -80°C |
Preparation Instructions:
Centrifuge the vial before open the cap and reconstitute in water. Adding of 10 mM β-mercaptoethanol or 1 mM DTT into the solution to protect the protein is recommended and using of non-ionic detergents such as n-Dodecyl β-D-maltoside (DoDM) or polyethylene detergents (e.g. C12E10) also help to stabilize the protein. Avoid repeated freezing and thawing after reconstitution. The purity of His-tagged Rab7 was determined by SDS- PAGE and Coomassie Brilliant Blue Staining. |
 |
References:
1. Edinger, A. L. et al., Dev. Cell 5: 571-582, 2003. 2. Houlden, H. et al., Ann. Neurol. 56: 586-590, 2004.
3. Meggouh, F. et al., Neurology 67: 1476-1478, 2006.
4. Rak, A. et al., Cell 117: 749-760, 2004.
5. Verhoeven, K. et al., Am. J. Hum. Genet. 72: 722-727, 2003. |
